HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A829R209",
"id": "A0A829R209_LISGR",
"source_organism": {
"taxId": "1265827",
"scientificName": "Listeria grayi FSL F6-1183",
"fullName": "Listeria grayi FSL F6-1183"
},
"name": "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase",
"description": [
"Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP)"
],
"length": 157,
"sequence": "MIRIGQGYDVHQLAENRKLIIGGIEIPHELGLLGHSDADVLLHAITDAIIGAVCKRDIGYFFPDTDDQYKDADSSQLLSIIWKEIQQDGYQLGNLDCTVIAEKPKMAPYIEAMREHIAELLGAELDQVNVKATTSEMMGFVGREEGIASLAVVLLEK",
"proteome": null,
"gene": "ispF",
"go_terms": [
{
"identifier": "GO:0008685",
"name": "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016114",
"name": "terpenoid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4806cfc55513dcfafc7c50c91b7c811c37f0503d",
"counters": {
"domain_architectures": 17724,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17724
}
}
}