HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A829NYE6",
"id": "A0A829NYE6_MEDG5",
"source_organism": {
"taxId": "1073375",
"scientificName": "Mediterraneibacter gnavus (strain CC55_001C)",
"fullName": "Mediterraneibacter gnavus (strain CC55_001C)"
},
"name": "Large ribosomal subunit protein bL20",
"description": [
"Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit"
],
"length": 118,
"sequence": "MARIKGGMNAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSAYAGRKERKRQMRQLWIARINAAARMNGLSYSKFMHGLKVAGVDMNRKMLAELAVSDKEGFATLAELAKSKLA",
"proteome": "UP000018690",
"gene": "rplT",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019843",
"name": "rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dd0106d2fa935591bf6db4691453259ee8aeb0c1",
"counters": {
"domain_architectures": 40505,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40505
}
}
}