HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing:
Vary: Accept
{
"metadata": {
"accession": "A0A829HB51",
"id": "A0A829HB51_9GAMM",
"source_organism": {
"taxId": "1217657",
"scientificName": "Acinetobacter gyllenbergii CIP 110306 = MTCC 11365",
"fullName": "Acinetobacter gyllenbergii CIP 110306 = MTCC 11365"
},
"name": "Dihydroorotate dehydrogenase (quinone)",
"description": [
"Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor"
],
"length": 335,
"sequence": "MLYSLARPLLFTLAPERAHELTLSMLDKAHKLGFMHQKVAAKPVTCMGIEFPNPVGLAAGLDKNGAHIDALAALGFGFIEIGTITPRPQAGNPQPRLFRIPQAKAIINRMGFNNDGVDKLIENVKASKFKGVLGINIGKNADTPVEDAVSDYLICLEKVYNYASYITVNISSPNTKNLRSLQSGDALTELLQTLKDRQLELADQYNHYVPLVLKVAPDLSSEDIHFIAAQLLQFKIDGLIVTNTTLGRDGVENLPNGNEAGGLSGAPVFEKSTECLRQFAEVLAGQIPLIGVGGILMGEQAVAKQQAGASLVQVYSGLIYTGPTLVKDCVDAMTV",
"proteome": "UP000014523",
"gene": "pyrD",
"go_terms": [
{
"identifier": "GO:0004152",
"name": "dihydroorotate dehydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006207",
"name": "'de novo' pyrimidine nucleobase biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016627",
"name": "oxidoreductase activity, acting on the CH-CH group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0006222",
"name": "UMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "386746119d361a60cfbbc9964fada353b1100670",
"counters": {
"domain_architectures": 37617,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 5,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 37617
}
}
}