HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A822N2C9",
"id": "A0A822N2C9_9VIBR",
"source_organism": {
"taxId": "246167",
"scientificName": "Vibrio crassostreae",
"fullName": "Vibrio crassostreae"
},
"name": "Ion-translocating oxidoreductase complex subunit G",
"description": [
"Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane"
],
"length": 209,
"sequence": "MLNAIKKNGLVLAIFACASTGLVAVTHYLTKDQIKQQEQAQLLSVLNQVIPHDLHDNELFSACTLVQAEELGTEQAMPAYIAKLNGEPSAIAIEAIAPDGYNGAIKVIVGMKIDGTILGTRVLSHQETPGLGDKIDLRVSDWILSFAGKQVTDSNLDRWKVRKDGGDFDQFTGATITPRAVVKSVKQAVQYVNQNNQALLAQPLNCGGE",
"proteome": "UP000049077",
"gene": "rnfG",
"go_terms": [
{
"identifier": "GO:0010181",
"name": "FMN binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0022900",
"name": "electron transport chain",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cbf2b81fd0507e7f078adfabe4266c86dc1401e4",
"counters": {
"domain_architectures": 17570,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"smart": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"pirsf": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17570
}
}
}