GET /api/protein/UniProt/A0A816R9S2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A816R9S2",
        "id": "A0A816R9S2_9BILA",
        "source_organism": {
            "taxId": "392030",
            "scientificName": "Rotaria magnacalcarata",
            "fullName": "Rotaria magnacalcarata"
        },
        "name": "Phospholipase B1, membrane-associated",
        "description": [
            "Calcium-independent membrane-associated phospholipase that catalyzes complete diacylation of phospholipids by hydrolyzing both sn-1 and sn-2 fatty acyl chains attached to the glycerol backbone (phospholipase B activity). Has dual phospholipase and lysophospholipase activities toward diacylphospholipids. Preferentially cleaves sn-2 ester bonds over sn-1 bonds. Acts as a lipase toward glycerolipid substrates. Hydrolyzes fatty acyl chains of diacylglycerols with preference for the sn-2 position and of triacylglycerols with not positional selectivity. May also hydrolyze long chain retinyl esters such as retinyl palmitate. May contribute to digestion of dietary phospholipids, glycerolipids and retinoids, facilitating lipid absorption at the brush border"
        ],
        "length": 374,
        "sequence": "MLLSYYTLILTCGIAIVASNRAHTPWERAKLLGPLTFTDARVDFQCTALTPSPTVPTSVHALRPADIKYIGAIGDSLTAANGAKAWTIIGLLTENRGVSWSIGGERDLSSVVTLPNIMREFNFKLYGQSSGNGNQNSSSAVFNVAKPGAVSADMPGQANLLVDRMIEYLGVNKFNSEWKLVTFFIGGNDLCAYCEDNNRYSASAYKSNVQTTLNILRDRMPRTIVNFVTVLNVAELEDLHEGVVCTNMQGFLCDCAIKPDTREQVRVANLAYQKVTNELIDSGIYDVKNDFTVVRQPFMEHMKVPNKPNNGGPDFDYFAPDCFHFSTKGHEAAAIELWNNMMEKVGQKTTLWDLKDTLKCPSAGNGYIYTSKNS",
        "proteome": null,
        "gene": "MBJ925_LOCUS16727",
        "go_terms": [
            {
                "identifier": "GO:0004620",
                "name": "glycerophospholipase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016788",
                "name": "hydrolase activity, acting on ester bonds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "90d647256e0676e68c000b40f22e4b286cb99f92",
        "counters": {
            "domain_architectures": 68651,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68651
        }
    }
}