GET /api/protein/UniProt/A0A811Z2Q5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A811Z2Q5",
"id": "A0A811Z2Q5_NYCPR",
"source_organism": {
"taxId": "34880",
"scientificName": "Nyctereutes procyonoides",
"fullName": "Nyctereutes procyonoides (Raccoon dog)"
},
"name": "Heat shock protein beta-1",
"description": [
"Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins"
],
"length": 209,
"sequence": "MTERRVPFSLLRSPSWDPFRDWYPAHSRLFDQAFGLPRLPEEWAQWFGHSGWPGYVRPIPPAVEGPAAAAAAAAPAYSRALSRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPMPKPATQSAEITIPVTFEARAQIGGPEAGKSEQSGAK",
"proteome": "UP000645828",
"gene": "NYPRO_LOCUS16820",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1a49c7cd006c7b597e6e0f45e18cc046e51a1431",
"counters": {
"domain_architectures": 86430,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 86430
}
}
}