General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A811Y543",
        "id": "A0A811Y543_NYCPR",
        "source_organism": {
            "taxId": "34880",
            "scientificName": "Nyctereutes procyonoides",
            "fullName": "Nyctereutes procyonoides (Raccoon dog)"
        },
        "name": "Photoreceptor-specific nuclear receptor",
        "description": [
            "Orphan nuclear receptor of retinal photoreceptor cells. Transcriptional factor that is an activator of rod development and repressor of cone development. Binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. Enhances rhodopsin expression. Represses M- and S-cone opsin expression"
        ],
        "length": 381,
        "sequence": "MAITGPRKASPGRWGLGEEPAGLGPPLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRRRLIYRCQVGAGTCPVDKAHRNQCQACRLKKCLQEGMNQDAVQNERQPRSAAQVRPGSGAPGSEPALESLGAPPAPASAAPGHHHFMASLITAETCAKLEPEDAEENIDVTSNDPECPSSPYSSSPPCGLDSIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAAPEGPATGSSQGRLALASAESRILQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITSERVELLFFRKTIGNTPMEKLLCDMFKN",
        "proteome": "UP000645828",
        "gene": "NYPRO_LOCUS5495",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4698babba05c618fbf7c3347fb2b74999f10e47e",
        "counters": {
            "domain_architectures": 65082,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "smart": 2,
                "profile": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 3,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65082
        }
    }
}