HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A804MX76",
"id": "A0A804MX76_MAIZE",
"source_organism": {
"taxId": "4577",
"scientificName": "Zea mays",
"fullName": "Zea mays (Maize)"
},
"name": "non-specific serine/threonine protein kinase",
"description": [
"CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner"
],
"length": 406,
"sequence": "MVGGGGGGPLRRVGKYEVGRTIGEGTFAKVKFAQNTETGESVAMKVLDRSSILKNKMAEQIRHGRLSEADARRYFQQLIDGVDFCHKKGVYHRDLKPENLLLDSQGNLKISDFGLSAWPAQGSFLLRTTCGTPNYVAPEVLSHKGYNGALADTWSCGVILYVLLAGYLPFDEVDLTTLYGKIESAEYSFPAWFSGGAKSLIRRILDPNPETRIRIEEIRSDEWFQKNYEPIKEIENEEVNLDDVNAAFDDPEDDNEDAFEDETGPLTLNAFDLIILSQGLNLAALFDRRQDCDKLQNRFLSRNPAKVILSSMEVVAQSMGFKTHIRNYKMRVEGLNADKTSHLSVMVEVFEVAPSIFMVELQRAAGDTSEYNTFVNNYCGKLDDIIWKFPTEKGKSRIPRLSKSHS",
"proteome": "UP000007305",
"gene": "LOC100193471",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "03b362773c0bf438b4565149c64ec4ff988a3ac8",
"counters": {
"domain_architectures": 14019,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"cathgene3d": 3,
"ssf": 1,
"smart": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14019
}
}
}