HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A804HPZ2",
"id": "A0A804HPZ2_MUSAM",
"source_organism": {
"taxId": "214687",
"scientificName": "Musa acuminata subsp. malaccensis",
"fullName": "Musa acuminata subsp. malaccensis (Wild banana)"
},
"name": "Xyloglucan endotransglucosylase/hydrolase",
"description": [
"Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues"
],
"length": 295,
"sequence": "MGLWLPSVVLLLCSAGFLALSSAAPANTSASFSFKENFDIMFAEDHFRTSPDGQIWYLYLDKKTGCGFQTRQRYRFGWFSMKLKLVGGDSAGVVTAYYMCSDLDAAPDRDELDFEFLGNRTGQPYTIQTNVYKSGIGGREMRHTLWFDPTQDFHTYSILWNTHRIVFYVDRVAIRVYKNNGKPNNFFPSGKPMYMFSSIWNADDWATRGGLEKTDWKKAPFVSSYKDFHADGCQWKDPFPACVSTTTEHWWDQYEAWSLTDSQQEDFSWVGRNLVIYDYCKDTERYPKLPEECLL",
"proteome": "UP000012960",
"gene": "GSMUA_287660.1",
"go_terms": [
{
"identifier": "GO:0004553",
"name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016762",
"name": "xyloglucan:xyloglucosyl transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010411",
"name": "xyloglucan metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042546",
"name": "cell wall biogenesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0044042",
"name": "glucan metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005618",
"name": "cell wall",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0048046",
"name": "apoplast",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c66f6453f0fcaa3e97e9e976c478e6b228c095ee",
"counters": {
"domain_architectures": 15114,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15114
}
}
}