General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A803Y2G2",
        "id": "A0A803Y2G2_MELGA",
        "source_organism": {
            "taxId": "9103",
            "scientificName": "Meleagris gallopavo",
            "fullName": "Meleagris gallopavo (Wild turkey)"
        },
        "name": "Regulator of G-protein signaling 4",
        "description": [
            "Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein"
        ],
        "length": 209,
        "sequence": "MCKGLAALPATCLKSAKDMKHRLGVLLQKSDSCDYGSSQGKREKVSPSQRVSQEEVKKWAESLENLIHHDRGLAAFRAFLKSEYSEENIEFWVSCEDYKKTKSPAKLSPKARKIYDEFISVQATKEVNLDSCTREKTSHNMLEPTLSCFDEAQRKIFTLMEKDSYRRFLKSPYYLDLVSPPTAGCGPENCKRAQAHALDCNSNIISQCA",
        "proteome": "UP000001645",
        "gene": "RGS4",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3962b823cbd84ba1c9ff3d7eb9ca5befd0245855",
        "counters": {
            "domain_architectures": 22883,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22883
        }
    }
}