GET /api/protein/UniProt/A0A803TVA7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A803TVA7",
"id": "A0A803TVA7_ANOCA",
"source_organism": {
"taxId": "28377",
"scientificName": "Anolis carolinensis",
"fullName": "Anolis carolinensis (Green anole)"
},
"name": "Beta-catenin-interacting protein 1",
"description": [
"Prevents the interaction between CTNNB1 and TCF family members, and acts as a negative regulator of the Wnt signaling pathway"
],
"length": 81,
"sequence": "MNREGVPGKSPEEMYIQQKVRVLLMLRKMGSNLTTSEEEFLRTYAGVVNSQLSQLPQHSIDQGAEDGVMAFSRSETEDRRQ",
"proteome": "UP000001646",
"gene": "CTNNBIP1",
"go_terms": [
{
"identifier": "GO:0008013",
"name": "beta-catenin binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cb5e32263da2534e6125f52c80fb364a0a04b9f1",
"counters": {
"domain_architectures": 2090,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2090
}
}
}