HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A803TKN5",
"id": "A0A803TKN5_ANOCA",
"source_organism": {
"taxId": "28377",
"scientificName": "Anolis carolinensis",
"fullName": "Anolis carolinensis (Green anole)"
},
"name": "L-lactate dehydrogenase",
"description": null,
"length": 302,
"sequence": "MASLKDKLITPIAQPATEPINKVTIVGVGQVGMACAISVLEKGLCDELALVDVLEDKLKGEMMDLQHGSLFLKTHKIIAGKDYAVTANSKVVVVTAGVRQQEGETRLDLVQRNVNVFKFIIPQVVKYSPDCIILVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRFLMGEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQDLNPALGSDQDPEGWKQVHKQVVDSAYEVIKLKGYTNWAIGLSVADLLETIMKNLCRVHPVSTMVKVSVSLDLCRDEQIHRRWRPITINL",
"proteome": "UP000001646",
"gene": "ldhb",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016616",
"name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019752",
"name": "carboxylic acid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004459",
"name": "L-lactate dehydrogenase (NAD+) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "efa9ddffcabca3280ae0d7a3462c2f8e6d373a42",
"counters": {
"domain_architectures": 58034,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"pfam": 2,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 58034
}
}
}