GET /api/protein/UniProt/A0A803SRD6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A803SRD6",
"id": "A0A803SRD6_ANOCA",
"source_organism": {
"taxId": "28377",
"scientificName": "Anolis carolinensis",
"fullName": "Anolis carolinensis (Green anole)"
},
"name": "Nitric oxide synthase-interacting protein",
"description": [
"Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity"
],
"length": 299,
"sequence": "MTRHGKNCTAGAVYTYHEKKKDTAASGYGTQNVRLSKDAVKDFDCCCLSLQPCKDPVVTPDGYLYEKEAILEYILHQKKEIARQMKAYEKQKNEKKLEMAELSKAAKESKVKNFLDKELSIVSKPLNPFDHKAGDSEPGPSSEDKDKKLPSFWIPSLTPEAKTKVIPKPDKCVYCPMSRKPLKLKDLTPVHFTPVDSSVDRVGLINRQDRYVCAVTRDMLGNSVPCAVLRPSGSVVTLECVEKLIKKDMVDPMNGEKLTDKDIIVLQRTWKNGQGQDRMATTSNGKRISCFGNDQKMAA",
"proteome": "UP000001646",
"gene": "NOSIP",
"go_terms": [
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83c482acabf099c0fefc45647ca18faf4f9b04d0",
"counters": {
"domain_architectures": 2553,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2553
}
}
}