General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A803K6D4",
        "id": "A0A803K6D4_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Insulin-like growth factor-binding protein 4",
        "description": [
            "IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors"
        ],
        "length": 286,
        "sequence": "MMSGNCHPALLLLVLATFGMAEDAAIQCPPCSQEKLIRCTDPVGCQELVKEPGCGCCATCALPKGAPCGVYTARCGTGLRCYPPRGSEKPLHTLMHGQGLCTEIGEIESITETFPKTEEDHPNISIHPCGQQDKMCIQKHQAKIHRSQGQSGKQFTKNTNNAPVPEIHLGVCQKDLNRALEKLAAYQTRTQEDFLSIPIPNCDRNGNYNPKQCHPALDGQRGKCWCVDRKTGVKLHIPYDPVLDADCQQIKILSSVKPKQSLEASRARRTLQRGVTARVCGGPKAT",
        "proteome": "UP000008143",
        "gene": "igfbp4",
        "go_terms": [
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005520",
                "name": "insulin-like growth factor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "04f1dcc8320610e83d29558d2d032a1270352705",
        "counters": {
            "domain_architectures": 3746,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 2,
                "smart": 2,
                "pfam": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3746
        }
    }
}