GET /api/protein/UniProt/A0A7Z7J9X2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7Z7J9X2",
        "id": "A0A7Z7J9X2_9BURK",
        "source_organism": {
            "taxId": "164546",
            "scientificName": "Cupriavidus taiwanensis",
            "fullName": "Cupriavidus taiwanensis"
        },
        "name": "Formate-dependent phosphoribosylglycinamide formyltransferase",
        "description": [
            "Involved in the de novo purine biosynthesis. Catalyzes the transfer of formate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR). Formate is provided by PurU via hydrolysis of 10-formyl-tetrahydrofolate"
        ],
        "length": 401,
        "sequence": "MTTLGTPLSPSATKVMLLGSGELGKEVLIALQRLGVETIAVDRYDNAPGQQVAHHARTIAMSDPDQLKALIEAEKPHLVVPEIEAIATPMLETLEAAGTVRVIPTARAARLTMDREGIRRLAAESLGLPTSPYKFCDSLEELQAAIDGGIGYPCVVKPVMSSSGKGQSKIDGPEGVKAAWDYAMAGGRVSHGRVIVEGFIDFDYEITLLTVRAIGASGQVETRFCAPIGHVQVSGDYVESWQPQPMHPAALASAQRIAQAVTADLGGMGLFGVELFVKGEQVWFSEVSPRPHDTGMVTMATQWQNEFELHARAILGLPVDTTLRSPGASAVIYGGVEAQGVVFDGVDQALRVPQTEVRLFGKPESFARRRMGVALAYADDIDTARTRAKEAASRVRPRAVG",
        "proteome": null,
        "gene": "purT",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004644",
                "name": "phosphoribosylglycinamide formyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016742",
                "name": "hydroxymethyl-, formyl- and related transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009152",
                "name": "purine ribonucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f42dff74da88d62cefe15043d2adb61534e21d02",
        "counters": {
            "domain_architectures": 8313,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "profile": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 8
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8313
        }
    }
}