HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7Z7J9X2",
"id": "A0A7Z7J9X2_9BURK",
"source_organism": {
"taxId": "164546",
"scientificName": "Cupriavidus taiwanensis",
"fullName": "Cupriavidus taiwanensis"
},
"name": "Formate-dependent phosphoribosylglycinamide formyltransferase",
"description": [
"Involved in the de novo purine biosynthesis. Catalyzes the transfer of formate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR). Formate is provided by PurU via hydrolysis of 10-formyl-tetrahydrofolate"
],
"length": 401,
"sequence": "MTTLGTPLSPSATKVMLLGSGELGKEVLIALQRLGVETIAVDRYDNAPGQQVAHHARTIAMSDPDQLKALIEAEKPHLVVPEIEAIATPMLETLEAAGTVRVIPTARAARLTMDREGIRRLAAESLGLPTSPYKFCDSLEELQAAIDGGIGYPCVVKPVMSSSGKGQSKIDGPEGVKAAWDYAMAGGRVSHGRVIVEGFIDFDYEITLLTVRAIGASGQVETRFCAPIGHVQVSGDYVESWQPQPMHPAALASAQRIAQAVTADLGGMGLFGVELFVKGEQVWFSEVSPRPHDTGMVTMATQWQNEFELHARAILGLPVDTTLRSPGASAVIYGGVEAQGVVFDGVDQALRVPQTEVRLFGKPESFARRRMGVALAYADDIDTARTRAKEAASRVRPRAVG",
"proteome": null,
"gene": "purT",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004644",
"name": "phosphoribosylglycinamide formyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016742",
"name": "hydroxymethyl-, formyl- and related transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009152",
"name": "purine ribonucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f42dff74da88d62cefe15043d2adb61534e21d02",
"counters": {
"domain_architectures": 8313,
"entries": 22,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 3,
"profile": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8313
}
}
}