GET /api/protein/UniProt/A0A7Y9IPX4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7Y9IPX4",
        "id": "A0A7Y9IPX4_9BURK",
        "source_organism": {
            "taxId": "516702",
            "scientificName": "Pigmentiphaga litoralis",
            "fullName": "Pigmentiphaga litoralis"
        },
        "name": "Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C",
        "description": [
            "Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)"
        ],
        "length": 102,
        "sequence": "MALIENDVTRIARLARLDLAADQRPQVLNDLNGIFGLIEQLQSVDTKGVEPLTHPISAIEDVVLRLRADAVTETSGVDARSSLIANAPAIDDGLFLVPKVIE",
        "proteome": "UP000542125",
        "gene": "gatC",
        "go_terms": [
            {
                "identifier": "GO:0006450",
                "name": "regulation of translational fidelity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "18250786e3cb6183ae4d86d62ad3d105c32ab112",
        "counters": {
            "domain_architectures": 22404,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22404
        }
    }
}