General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7Y4GZJ3",
        "id": "A0A7Y4GZJ3_9BRAD",
        "source_organism": {
            "taxId": "2721160",
            "scientificName": "Bradyrhizobium archetypum",
            "fullName": "Bradyrhizobium archetypum"
        },
        "name": "Corrinoid adenosyltransferase",
        "description": [
            "Required for both de novo synthesis of the corrin ring for the assimilation of exogenous corrinoids. Participates in the adenosylation of a variety of incomplete and complete corrinoids"
        ],
        "length": 217,
        "sequence": "MTSEPDAAEDETVTSEASLDARHADKMAKKKAARDRMMAAKSSEKGLIIVHTGAGKGKSSSAFGMIMRCVAHGFCCAVVQFIKGAWETGERRLLTGHFGELCQFHAMGEGFTWETQDRARDIVAARAAWEKAKQLIADEALRMVVLDEINIALRYDYLEIGEVVEFLSNSKPPMTHVVLTGRNARQELIDAADLVTEMTLVKHPFRSGIKAQPGVEY",
        "proteome": "UP000528734",
        "gene": "cobO",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008817",
                "name": "corrinoid adenosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009236",
                "name": "cobalamin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2225aef9ebcf6711ad743793914a89df539206ff",
        "counters": {
            "domain_architectures": 4481,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4481
        }
    }
}