HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7W6K6M2",
"id": "A0A7W6K6M2_9SPHI",
"source_organism": {
"taxId": "1737356",
"scientificName": "Pedobacter zeae",
"fullName": "Pedobacter zeae"
},
"name": "Adenylosuccinate synthetase",
"description": [
"Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP"
],
"length": 426,
"sequence": "MTQVDVLLGLQWGDEGKGKIVDVLSPKYDLIARFQGGPNAGHTLEFDGKKFVLNTIPSGIFNEKTMNLIGNGVVIDPIILKRELDNLKKAGHDPVADGKLVIARKAHLILPTHQLLDAANEARMGKNKIGSTLKGIGPTYMDKTGRNGLRVGDTTLPDFKERYAKLVEKHTEILSHYEGFEYELAEKETAFFEAIEFLKAIPHVDSEHFVNGYLKEGKAVLAEGAQGTLLDVDFGSYPFVTSSNTTTAGACTGLGIAPNKVGAVYGIFKAYCTRVGGGPFPTELDNEVGENLRALGHEFGATTGRARRCGWIDLPALKYAIMLNGVTELIMMKADVLDTFDTIYACTHYEYNGETIDYMPYDIISIEPKPVLKAIEGWATDVTKITSVDEIPAKLTEYIAFLEKELEVPIKFLSVGPDRAQTLELH",
"proteome": "UP000642938",
"gene": "purA",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004019",
"name": "adenylosuccinate synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006164",
"name": "purine nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "37cd307e3eb176206c7f16cb37bf0a0b66a13b7b",
"counters": {
"domain_architectures": 35081,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"smart": 1,
"cathgene3d": 3,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"prosite": 2,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 35081
}
}
}