GET /api/protein/UniProt/A0A7W2FQG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7W2FQG8",
        "id": "A0A7W2FQG8_9VIBR",
        "source_organism": {
            "taxId": "2758441",
            "scientificName": "Vibrio marinisediminis",
            "fullName": "Vibrio marinisediminis"
        },
        "name": "Dihydrofolate synthase/folylpolyglutamate synthase",
        "description": [
            "Functions in two distinct reactions of the de novo folate biosynthetic pathway. Catalyzes the addition of a glutamate residue to dihydropteroate (7,8-dihydropteroate or H2Pte) to form dihydrofolate (7,8-dihydrofolate monoglutamate or H2Pte-Glu). Also catalyzes successive additions of L-glutamate to tetrahydrofolate or 10-formyltetrahydrofolate or 5,10-methylenetetrahydrofolate, leading to folylpolyglutamate derivatives"
        ],
        "length": 421,
        "sequence": "MSQPLIPQATSPLSMWLDYLANIHTSAIDLGLERVHAVASQANLIKPAPTVITVAGTNGKGSTCALMEAILLDAGYSVGVYSSPHLIRYNERVRINGQDLCDEKHVQAFDFIEKQRGEISLSFFEYGTLAALRSFQTEQVDIVLLEVGLGGRLDATNVVDHDVSVITSLAIDHVDWLGDDINVIGFEKAGIFRSGKPAICGQPKAPATVAAHADDISAELFQVGIQYDYALTENNAWRWSHGSFQLDALPVPNLPLPNAATALMALASAHLDISDVNIVNGLKQATLPGRMQLINQQPTVLLDVAHNPHSAQYLVEQVTLQYPAKTIHMVIAMLHDKDIQSTIEILSPLASYWYPASLSGPRAATAAELCQYLPEGQMQYSKPVLAFDTAMTQAKEEDVIIVVGSFHTVGEVLEHWQEKGE",
        "proteome": "UP000571701",
        "gene": "folC",
        "go_terms": [
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016881",
                "name": "acid-amino acid ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004326",
                "name": "tetrahydrofolylpolyglutamate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009396",
                "name": "folic acid-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e6ab2b5b1f832ff43dbb14fcfeb9fea358486a52",
        "counters": {
            "domain_architectures": 37786,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37786
        }
    }
}