General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7U9IT76",
        "id": "A0A7U9IT76_ECOLX",
        "source_organism": {
            "taxId": "1280986",
            "scientificName": "Escherichia coli HVH 36 (4-5675286)",
            "fullName": "Escherichia coli HVH 36 (4-5675286)"
        },
        "name": "tRNA(fMet)-specific endonuclease VapC",
        "description": [
            "Toxic component of a toxin-antitoxin (TA) system. A site-specific tRNA-(fMet) endonuclease, it cleaves both charged and uncharged tRNA-(fMet) between positions 38 and 39 at the anticodon stem-loop boundary. Its toxic effects are neutralized by expression of cognate antitoxin VapB"
        ],
        "length": 138,
        "sequence": "MNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRAAVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR",
        "proteome": null,
        "gene": "vapC",
        "go_terms": [
            {
                "identifier": "GO:0004540",
                "name": "RNA nuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "efa7cc22836035cd52b011ac128df8b7783ede4e",
        "counters": {
            "domain_architectures": 62123,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 62123
        }
    }
}