GET /api/protein/UniProt/A0A7U7EZS3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7U7EZS3",
        "id": "A0A7U7EZS3_STAAU",
        "source_organism": {
            "taxId": "1074919",
            "scientificName": "Staphylococcus aureus subsp. aureus ST228",
            "fullName": "Staphylococcus aureus subsp. aureus ST228"
        },
        "name": "Small ribosomal subunit protein uS3",
        "description": [
            "Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation"
        ],
        "length": 217,
        "sequence": "MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAANRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIARQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRADIDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK",
        "proteome": null,
        "gene": "rpsC",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5cb1e9a9ec1b7bb984d56f071ef67f2bd14a35bd",
        "counters": {
            "domain_architectures": 31176,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "profile": 2,
                "smart": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 31176
        }
    }
}