GET /api/protein/UniProt/A0A7U6RBT5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7U6RBT5",
        "id": "A0A7U6RBT5_PSEPU",
        "source_organism": {
            "taxId": "303",
            "scientificName": "Pseudomonas putida",
            "fullName": "Pseudomonas putida"
        },
        "name": "Probable septum site-determining protein MinC",
        "description": [
            "Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization"
        ],
        "length": 253,
        "sequence": "MQTMSPNHTPDTASVFQLKGSMLAITVLELARNDLEALDRQLAAKVAQAPNFFSNTPLVLALDKLPADEGAIDLPGLMRICRHHGLRTLAIRANRIEDIAAAIAIDLPVLPPSGARERPLEPEPEVVRKPEPAPAPPPAPEPEVRPTRIITSPVRGGQQIYAQGGDLIVTASVSPGAELLADGNIHVYGAMRGRALAGIKGNTKARIFCQQMTAEMVSIAGQYKVCEDLRRDPLWGTGVQVSLSGDVLNITRL",
        "proteome": null,
        "gene": "minC",
        "go_terms": [
            {
                "identifier": "GO:0051302",
                "name": "regulation of cell division",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000902",
                "name": "cell morphogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0051726",
                "name": "regulation of cell cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1901891",
                "name": "regulation of cell septum assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3acefdab8ecad1be8c4c0d76557e9d1f0c2185e2",
        "counters": {
            "domain_architectures": 6683,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6683
        }
    }
}