HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7U5HLI1",
"id": "A0A7U5HLI1_9CORY",
"source_organism": {
"taxId": "2320431",
"scientificName": "Corynebacterium silvaticum",
"fullName": "Corynebacterium silvaticum"
},
"name": "ATP synthase subunit c",
"description": [
"F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation",
"Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits"
],
"length": 77,
"sequence": "MNEAILAASDTAVSGSIATVGYGLATIGPGLGILVGKALEGMARQPEMAGQLRTTMFLGIAFVEALALIGLVAGFIL",
"proteome": "UP000195652",
"gene": "atpE",
"go_terms": [
{
"identifier": "GO:0015078",
"name": "proton transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1902600",
"name": "proton transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0033177",
"name": "proton-transporting two-sector ATPase complex, proton-transporting domain",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045259",
"name": "proton-transporting ATP synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d0c91cd7e80ef1f8ea234c0ac103454bbd7aff98",
"counters": {
"domain_architectures": 49652,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 49652
}
}
}