HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7U4P6D1",
"id": "A0A7U4P6D1_9BURK",
"source_organism": {
"taxId": "430531",
"scientificName": "Burkholderia humptydooensis",
"fullName": "Burkholderia humptydooensis"
},
"name": "HPr kinase/phosphorylase",
"description": [
"Catalyzes the ATP- as well as the pyrophosphate-dependent phosphorylation of a specific serine residue in HPr, a phosphocarrier protein of the phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS). HprK/P also catalyzes the pyrophosphate-producing, inorganic phosphate-dependent dephosphorylation (phosphorolysis) of seryl-phosphorylated HPr (P-Ser-HPr)"
],
"length": 322,
"sequence": "MDTSSINAQSIFDDNAAMLKLSWLTGHEGWERGFSADTVANATSSADLVGHLNLIHPNRIQVLGEAEIDYYQRQTDEDRSRHMAELIALEPPFLVVAGGAAAPPELVLRCTRSSTPLFTTPMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDSGLGKSELGLELISRGHGLVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTIFGETAVRRKMKLKLIVQLVRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVLVEAAVRNTILQLRGIDTLRDFMDRQRLAMQDPDSQFPGKLV",
"proteome": null,
"gene": "hprK",
"go_terms": [
{
"identifier": "GO:0000155",
"name": "phosphorelay sensor kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000160",
"name": "phosphorelay signal transduction system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006109",
"name": "regulation of carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d357e6f73d5895aa8e8bb0c47224ff5b32885360",
"counters": {
"domain_architectures": 7521,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7521
}
}
}