GET /api/protein/UniProt/A0A7U3UUQ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7U3UUQ7",
        "id": "A0A7U3UUQ7_9ACTN",
        "source_organism": {
            "taxId": "659352",
            "scientificName": "Actinacidiphila reveromycinica",
            "fullName": "Actinacidiphila reveromycinica"
        },
        "name": "Fructose-bisphosphate aldolase",
        "description": [
            "Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis"
        ],
        "length": 340,
        "sequence": "MPIATPEVYGEMLDRAKAGNFAYPAINVTSSQTLHAALRGLAEAESDGIIQISTGGAEFLGGQYSKDMVTGAVALAEFAHIVAEKYPVTVALHTDHCPKDKLDGYVRPLLKISQERVAAGRNPLFQSHMWDGSAETLDDNLAIAKELLAEAVKAKIILEMEITPTGGEEDGVSHEINDSLYTTVDDAFRTVEAVGLGEHGRYLLAASFGNVHGVYKPGNVVLRPGILRELQDAVAQKYGKADAFDFVFHGGSGSTIDEINEALENGVVKMNIDTDLQYAFTRPVAGHMFSNYDGVLKVDGEVGNKKAYDPRVWGKAAEAGMAARVVVAAQDLRSAGNRRK",
        "proteome": "UP000595703",
        "gene": "RVR_5580",
        "go_terms": [
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016832",
                "name": "aldehyde-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004332",
                "name": "fructose-bisphosphate aldolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006096",
                "name": "glycolytic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8c0364264c9f1b524fbc33b875589c3189c17e00",
        "counters": {
            "domain_architectures": 39064,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 3,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 39064
        }
    }
}