GET /api/protein/UniProt/A0A7U2I907/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7U2I907",
"id": "A0A7U2I907_PHANO",
"source_organism": {
"taxId": "321614",
"scientificName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)",
"fullName": "Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus)"
},
"name": "Carboxylic ester hydrolase",
"description": [
"Esterase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose"
],
"length": 303,
"sequence": "MQVLTTLLLAASATAQLTSKLTQITDFGPNPRNVEMHIYVPANLQANPPILVTPHWCGGTAQQNFEWRAWASAGDKYGFITIYPNTTNADRCWDVSSKATLTHDGGGDSLGIASMVRWALEKYHGDPDRVFVQGTSSGAMMTNVLIGAYPDLFAAGSAWAGVPFGCYAGDGFDVWNPDCAAGKIIKTGAEWAAIVHAAFPDYQAFRPKFQTFHGLADTTISPQNLKEQIKQWTAVLGVSETPSSTTQDTPLTGWTRYQYGDKFEAYEAAGVTHNIPTQDDLVIDYFDLRCQKSETTKCYSRRS",
"proteome": "UP000663193",
"gene": "JI435_154510",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "936199bfe3572887dbf3175e7d28e1c0c9bbf118",
"counters": {
"domain_architectures": 8736,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"ncbifam": 2,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8736
}
}
}