GET /api/protein/UniProt/A0A7S8F3W1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7S8F3W1",
"id": "A0A7S8F3W1_9SPHN",
"source_organism": {
"taxId": "2782568",
"scientificName": "Qipengyuania soli",
"fullName": "Qipengyuania soli"
},
"name": "Kynurenine formamidase",
"description": [
"Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation"
],
"length": 209,
"sequence": "MSRIRDISQTLRPSLPVWPGDTEFAFDRTWKMEDGSPVNVGRMTMSTHSGTHGDAPLHYSATAEDIASVSLDPYLGECLVVDARAARGWVQIADLPDLGGATRVLLRTYERFPHDQWDSDFTAIAAEMIDWLAGQGVVLIGTDAPSVDPQESKTMDAHKAVLANDMRILEGLVLDDVPPGRYELIALPLKITGGDAGLCRAVLRELPDA",
"proteome": "UP000594459",
"gene": "kynB",
"go_terms": [
{
"identifier": "GO:0004061",
"name": "arylformamidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019441",
"name": "L-tryptophan catabolic process to L-kynurenine",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004328",
"name": "formamidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "382acaffa13de6f284c4d8c0c6150d3c91f7efb8",
"counters": {
"domain_architectures": 31425,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 31425
}
}
}