HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7S5E0E2",
"id": "A0A7S5E0E2_9POAL",
"source_organism": {
"taxId": "1482639",
"scientificName": "Sucrea monophylla",
"fullName": "Sucrea monophylla"
},
"name": "Photosystem II reaction center protein Z",
"description": [
"Controls the interaction of photosystem II (PSII) cores with the light-harvesting antenna, regulates electron flow through the 2 photosystem reaction centers. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation",
"May control the interaction of photosystem II (PSII) cores with the light-harvesting antenna, regulates electron flow through the 2 photosystem reaction centers. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation"
],
"length": 62,
"sequence": "MTIAFQLAVFALIATSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAILNSLIS",
"proteome": null,
"gene": "psbZ",
"go_terms": [
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042549",
"name": "photosystem II stabilization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009523",
"name": "photosystem II",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009539",
"name": "photosystem II reaction center",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "54390648ce66c90ce17cf9e726aea0f412b9057c",
"counters": {
"domain_architectures": 15039,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15039
}
}
}