GET /api/protein/UniProt/A0A7S4M381/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7S4M381",
"id": "A0A7S4M381_9EUKA",
"source_organism": {
"taxId": "72548",
"scientificName": "Prymnesium polylepis",
"fullName": "Prymnesium polylepis"
},
"name": "Cysteine protease",
"description": [
"Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins"
],
"length": 142,
"sequence": "EYVPCLQAMFELPQSLGIIGGRPRRSHYFVGCQGDQLLYLDPHEVQPALSAQEPALASCHFPHIIRTTPLREIDPSLALGFLCKSKAEVDDLCSRCEGAFARGLPLFSMSAGGPPEWRGSGPDIDDDDDGEGEGEEEDMVLV",
"proteome": null,
"gene": "CPOL0286_LOCUS3916",
"go_terms": [
{
"identifier": "GO:0008234",
"name": "cysteine-type peptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019786",
"name": "protein-phosphatidylethanolamide deconjugating activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6d3a3c7a42f0bbe649d79e43e20fc010e35776db",
"counters": {
"domain_architectures": 8470,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8470
}
}
}