General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7R7ZMU7",
        "id": "A0A7R7ZMU7_ASPCH",
        "source_organism": {
            "taxId": "182096",
            "scientificName": "Aspergillus chevalieri",
            "fullName": "Aspergillus chevalieri"
        },
        "name": "Phosphoglycerate kinase",
        "description": [
            "Catalyzes one of the two ATP producing reactions in the glycolytic pathway via the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. Both L- and D- forms of purine and pyrimidine nucleotides can be used as substrates, but the activity is much lower on pyrimidines. Negatively regulates the biosynthesis of acetyl-CoA from pyruvate in the mitochondrion"
        ],
        "length": 417,
        "sequence": "MSLSNKVAITDVDLKDKRVLIRVDFNVPLDADKKITNNQRIVGALPTIKYAVENGAKAVILMSHLGRPDGKVNPKYSLKPVVPELEKLLGRSVVFAEDSVGKETEETVNKASGGQIVLLENLRFHAEEEGSSKDEQGNKVKADKEKVAEFRKGLTALGDVYINDAFGTAHRAHSSMVGVDLPQKASGFLVKKELDYFATALENPQRPFLAILGGAKVSDKIQLIDNLLPKVNSLIITGAMAFTFKKTLEGVKIGNSLFDEAGSKIVGEITEKAKKHNVEIVLPVDYVTADKFAADAKTGYATDADGIPDGYMGLDVGEKSVELYKKTIASAKTILWNGPPGVFEMEPFANATKKTLDAAVAAAQAGTIVIIGGGDTATVAAKYGAEEKLSHVSTGGGASLELLEGKDLPGVAALSSK",
        "proteome": "UP000637239",
        "gene": "PGK1",
        "go_terms": [
            {
                "identifier": "GO:0004618",
                "name": "phosphoglycerate kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006096",
                "name": "glycolytic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c502ec34008dc13b0f4c71c93072b1efe80d5ba",
        "counters": {
            "domain_architectures": 36333,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 36333
        }
    }
}