HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7R6P6H0",
"id": "A0A7R6P6H0_9GAMM",
"source_organism": {
"taxId": "1441457",
"scientificName": "Neptunomonas japonica JAMM 1380",
"fullName": "Neptunomonas japonica JAMM 1380"
},
"name": "Phosphopantetheine adenylyltransferase",
"description": [
"Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate"
],
"length": 167,
"sequence": "MNIAIYPGTFDPITNGHSDLVQRASRLFDKVIVAVATSQTKKPLFPLEKRTSLAKEVFAHLDNVEVIGFDCLLADFVAQQNANIILRGLRAVSDFEYEFQLANMNRQLAPQAESLFLTPAEHLSFISSTLIREIALLNGDVSKFVHPAVNKALKNHLAVRKDCKKSS",
"proteome": "UP000595332",
"gene": "coaD",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004595",
"name": "pantetheine-phosphate adenylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015937",
"name": "coenzyme A biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "67074276eca3dd0a1392f72a13e344b6dc27e68b",
"counters": {
"domain_architectures": 82434,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ncbifam": 2,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 82434
}
}
}