General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7R5KS37",
        "id": "A0A7R5KS37_9PASS",
        "source_organism": {
            "taxId": "649802",
            "scientificName": "Pipra filicauda",
            "fullName": "Pipra filicauda (Wire-tailed manakin)"
        },
        "name": "BolA-like protein 3",
        "description": [
            "Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with NFU1"
        ],
        "length": 94,
        "sequence": "MQLFLRCRSWRSLSSGSEGESHLTRVLRERFPRASSIKVVDISGGCGAMYEIHIESEEFREKRTVQQHQMVNQALSEEIKHMHGLRIFTSIPKP",
        "proteome": "UP000504627",
        "gene": "BOLA3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d02628378805a9123995853b9659d30e20733234",
        "counters": {
            "domain_architectures": 28812,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28812
        }
    }
}