GET /api/protein/UniProt/A0A7N9D5M6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7N9D5M6",
"id": "A0A7N9D5M6_MACFA",
"source_organism": {
"taxId": "9541",
"scientificName": "Macaca fascicularis",
"fullName": "Macaca fascicularis (Crab-eating macaque)"
},
"name": "Phosphomannomutase",
"description": [
"Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions"
],
"length": 219,
"sequence": "MDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCKQNIQSHLGEALIQDLINYCLSYIAKVKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTVGYSVTAPEDTRRICEELFS",
"proteome": "UP000233100",
"gene": "PMM2",
"go_terms": [
{
"identifier": "GO:0004615",
"name": "phosphomannomutase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009298",
"name": "GDP-mannose biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f76e44d8be205a2bfb272f9168b5af1ebaf94506",
"counters": {
"domain_architectures": 7140,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 2,
"ssf": 1,
"panther": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7140
}
}
}