GET /api/protein/UniProt/A0A7N9CVX5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7N9CVX5",
"id": "A0A7N9CVX5_MACFA",
"source_organism": {
"taxId": "9541",
"scientificName": "Macaca fascicularis",
"fullName": "Macaca fascicularis (Crab-eating macaque)"
},
"name": "N-acetylglucosamine-1-phosphotransferase subunit gamma",
"description": [
"Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high mannose glycans of the acceptor to the catalytic alpha and beta subunits (GNPTAB). Enhances the rate of N-acetylglucosamine-1-phosphate transfer to the oligosaccharides of acid hydrolase acceptors"
],
"length": 345,
"sequence": "MAAGLVRVLLFLGLSARGPAPAGAAKMKVVEEPNTFGVNNPFLPQASRLQAKRDPSPVSGSCSVKQALECSGTISAHCNLRFPGSSNSPASASRVGGTTGPAHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGVLGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRRWDQVEQDLADELITAQGHEKLLRTLFEDAGYFKAPEENEPTQLEGGPDSLGLETLENCRKAHKELSKEIKRLKGLLTQHGIPYVRPTETSSLEHLGHKTPRAKPPEQLRGDPGLRGSL",
"proteome": "UP000233100",
"gene": "GNPTG",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dcc8d10c08e0918019581acda7d632b21f320c77",
"counters": {
"domain_architectures": 5251,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 2,
"ssf": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5251
}
}
}