GET /api/protein/UniProt/A0A7N6FHE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N6FHE6",
        "id": "A0A7N6FHE6_ANATE",
        "source_organism": {
            "taxId": "64144",
            "scientificName": "Anabas testudineus",
            "fullName": "Anabas testudineus (Climbing perch)"
        },
        "name": "Guanine nucleotide exchange factor MSS4",
        "description": [
            "Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1, RAB3A and RAB10, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport"
        ],
        "length": 130,
        "sequence": "MDNNQQDKDNTDRSDLVSEDGKNSKSVLCQRCGSKVLCPGMAAFAEKELFLPSMRKKSGLSSTDGSVDGDTLTAHWLVDDMYTFENVGFTHDVGRIKYLICADCEIGPIGLHCLDDKKSFYIALERVNHA",
        "proteome": "UP000265040",
        "gene": "RABIF",
        "go_terms": [
            {
                "identifier": "GO:0005085",
                "name": "guanyl-nucleotide exchange factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007264",
                "name": "small GTPase-mediated signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1fabeff0acd708811406ecda84dce44467fa77a0",
        "counters": {
            "domain_architectures": 1736,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1736
        }
    }
}