GET /api/protein/UniProt/A0A7N6ANY0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N6ANY0",
        "id": "A0A7N6ANY0_ANATE",
        "source_organism": {
            "taxId": "64144",
            "scientificName": "Anabas testudineus",
            "fullName": "Anabas testudineus (Climbing perch)"
        },
        "name": "N-ethylmaleimide-sensitive factor attachment protein, beta b",
        "description": [
            "Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus"
        ],
        "length": 217,
        "sequence": "MHFARLHVSKCSYRTNTTVPPVSSMQEMPTRSLTLMGRFTIAAKHHISIAEIYESELVDIEKAIAHYEQAADYYKGEESNSSANKCLLKVGAYCAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKEYFFKAALCHFIVDELNAKIAVEKYEEMFPAFSDSRECKLLKKLLEAHEEQNSEAFTEAVKEFDSISRLDQWHTTLLLRIKKTIQGDEGDLK",
        "proteome": "UP000265040",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006886",
                "name": "intracellular protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5b0c27421c7a6a08819c4985a5bcbf1712deca25",
        "counters": {
            "domain_architectures": 11254,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11254
        }
    }
}