HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7N5KQX1",
"id": "A0A7N5KQX1_AILME",
"source_organism": {
"taxId": "9646",
"scientificName": "Ailuropoda melanoleuca",
"fullName": "Ailuropoda melanoleuca (Giant panda)"
},
"name": "Probable arginine--tRNA ligase, mitochondrial",
"description": [
"Catalyzes the attachment of arginine to tRNA(Arg) in a two-step reaction: arginine is first activated by ATP to form Arg-AMP and then transferred to the acceptor end of tRNA(Arg)"
],
"length": 578,
"sequence": "MACAFRRSIACQLSRVLDLPPENLIKSISAVPISRKEEVADFQLSVDSVLENNNDHSRPDIQVQAMRLAEKLKCDTVVSEISTGQGTVNFKINRELLTKTVLQQVINDGSKYGLKSELFSGLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEATDDKNIAKSAHEFFQRLELGDTQALALWQKFRDLSIEEYVRIYKRLGVHFNEYSGESFYREKSQEVLKLLDSKGLLQKTVKGTAVVDLSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQMLQIMGYDWAERCRHVPFGVVQGMKTRRGNVTFLEDVLNEIRSRMLQNMASIKTTRELENPQETAERVGLAALIIQDFKGLLLSDYQFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCGYLNDFNTGCLQEPQSVSILQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAAVAHKTLFIKDSPPEVAGARLHLFRAVRSVLANGMKLLGITPVCRM",
"proteome": "UP000008912",
"gene": "RARS2",
"go_terms": [
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004814",
"name": "arginine-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006420",
"name": "arginyl-tRNA aminoacylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c8779618e100221334df916f5a0b4a6c63f59ba3",
"counters": {
"domain_architectures": 4716,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 2,
"cdd": 1,
"smart": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4716
}
}
}