GET /api/protein/UniProt/A0A7N5KQX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N5KQX1",
        "id": "A0A7N5KQX1_AILME",
        "source_organism": {
            "taxId": "9646",
            "scientificName": "Ailuropoda melanoleuca",
            "fullName": "Ailuropoda melanoleuca (Giant panda)"
        },
        "name": "Probable arginine--tRNA ligase, mitochondrial",
        "description": [
            "Catalyzes the attachment of arginine to tRNA(Arg) in a two-step reaction: arginine is first activated by ATP to form Arg-AMP and then transferred to the acceptor end of tRNA(Arg)"
        ],
        "length": 578,
        "sequence": "MACAFRRSIACQLSRVLDLPPENLIKSISAVPISRKEEVADFQLSVDSVLENNNDHSRPDIQVQAMRLAEKLKCDTVVSEISTGQGTVNFKINRELLTKTVLQQVINDGSKYGLKSELFSGLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEATDDKNIAKSAHEFFQRLELGDTQALALWQKFRDLSIEEYVRIYKRLGVHFNEYSGESFYREKSQEVLKLLDSKGLLQKTVKGTAVVDLSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQMLQIMGYDWAERCRHVPFGVVQGMKTRRGNVTFLEDVLNEIRSRMLQNMASIKTTRELENPQETAERVGLAALIIQDFKGLLLSDYQFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCGYLNDFNTGCLQEPQSVSILQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAAVAHKTLFIKDSPPEVAGARLHLFRAVRSVLANGMKLLGITPVCRM",
        "proteome": "UP000008912",
        "gene": "RARS2",
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004814",
                "name": "arginine-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006420",
                "name": "arginyl-tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006418",
                "name": "tRNA aminoacylation for protein translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c8779618e100221334df916f5a0b4a6c63f59ba3",
        "counters": {
            "domain_architectures": 4716,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4716
        }
    }
}