HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7N4UY21",
"id": "A0A7N4UY21_SARHA",
"source_organism": {
"taxId": "9305",
"scientificName": "Sarcophilus harrisii",
"fullName": "Sarcophilus harrisii (Tasmanian devil)"
},
"name": "Ethanolaminephosphotransferase 1",
"description": [
"Ethanolaminephosphotransferase that catalyzes the transfer of phosphoethanolamine (PE) from CDP-ethanolamine to lipid acceptors, the final step in the synthesis of PE via the 'Kennedy' pathway. PE is the second most abundant phospholipid of membranes in mammals and is involved in various membrane-related cellular processes. The enzyme is critical for the synthesis of several PE species and also catalyzes the synthesis of plasmanyl-PE, a lipid required for proper myelination and neurodevelopment, from 1-alkyl-2-acylglycerol"
],
"length": 389,
"sequence": "MLQLRYVTEEQLAGFDQYQYSAVDTNPLSVYIMQHLWNRIVKIVPLWIAPNLLTFSGFLLLLINYFVLCFYDWDYTASGSRLIPNWVWWFAALSTFSAYALDSIDGKHARRTQSSSPLGELFDHGLDSWATSLFTISWFSVCASPGDSPGFSKHTMFLFLSIVLLNFMLSHWEKYNTGVLFLPWGYDLSQVTLVAGYLLTAIVGVELWHKPLVFGYYITTVSMTLVIGCSIFLSLPHTLYNIYMAYQKKTLKKDSLYEALLPLVSPTLLFFLLTVWVALSPCDILIKQPRLFLFMVGVAFSSVACRVIVCQMSNTRSESFHYLLFPLALVVFAAVTGLLGRLEESVFKAFTALATVAHVHYGVCVVNIFFLFVFFPWNNKLKVIKEAAR",
"proteome": "UP000007648",
"gene": "LOC111719032",
"go_terms": [
{
"identifier": "GO:0016780",
"name": "phosphotransferase activity, for other substituted phosphate groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008654",
"name": "phospholipid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d6f44f91fd4815ce8d19cee6d0e80ac2449ec927",
"counters": {
"domain_architectures": 90890,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 90890
}
}
}