General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N4PI64",
        "id": "A0A7N4PI64_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Platelet-activating factor acetylhydrolase IB subunit alpha1",
        "description": [
            "Alpha1 catalytic subunit of the cytosolic type I platelet-activating factor (PAF) acetylhydrolase (PAF-AH (I)) heterotetrameric enzyme that catalyzes the hydrolyze of the acetyl group at the sn-2 position of PAF and its analogs and modulates the action of PAF. The activity and substrate specificity of PAF-AH (I) are affected by its subunit composition. Both alpha1/alpha1 homodimer (PAFAH1B3/PAFAH1B3 homodimer) and alpha1/alpha2 heterodimer(PAFAH1B3/PAFAH1B2 heterodimer) hydrolyze 1-O-alkyl-2-acetyl-sn-glycero-3-phosphoric acid (AAGPA) more efficiently than PAF, but they have little hydrolytic activity towards 1-O-alkyl-2-acetyl-sn-glycero-3-phosphorylethanolamine (AAGPE). Plays an important role during the development of brain"
        ],
        "length": 229,
        "sequence": "MSGDHNPASTPAPGQDVQGDGRWMSLHYRFVADSKDKEPEVVFIGDSLVQLLHQCELWRELFSPLHALNFGISGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNYGHTAEQVAAGIEAIVGLVNQRQPQARVVVLALLPRGQHPNPLRDKNRRVNELVRTALAGRPRAHFLDADPGFVHSDGTISHHDMYDYLHLTRLGYTPVCRALHALLLRLLAAGQGPPQLEPGP",
        "proteome": "UP000007648",
        "gene": "PAFAH1B3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "30e8efcaaad38566460605bbc3ff761efe17bab4",
        "counters": {
            "domain_architectures": 101760,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 101760
        }
    }
}