General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7N4NXX0",
        "id": "A0A7N4NXX0_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Small glutamine-rich tetratricopeptide repeat-containing protein alpha",
        "description": [
            "Co-chaperone that binds misfolded and hydrophobic patches-containing client proteins in the cytosol. Mediates their targeting to the endoplasmic reticulum but also regulates their sorting to the proteasome when targeting fails. Functions in tail-anchored/type II transmembrane proteins membrane insertion constituting with ASNA1 and the BAG6 complex a targeting module. Functions upstream of the BAG6 complex and ASNA1, binding more rapidly the transmembrane domain of newly synthesized proteins. It is also involved in the regulation of the endoplasmic reticulum-associated misfolded protein catabolic process via its interaction with BAG6: collaborates with the BAG6 complex to maintain hydrophobic substrates in non-ubiquitinated states. Competes with RNF126 for interaction with BAG6, preventing the ubiquitination of client proteins associated with the BAG6 complex. Binds directly to HSC70 and HSP70 and regulates their ATPase activity"
        ],
        "length": 284,
        "sequence": "MEDKKRLAYSIIQFLHDQLHHGGLSPDAQESLEVAIQCLETAFGVTVEDRDLAVSKTLPEIFEAATGKKDMSYIRRNSQPITLSDEDTAEAERLKTEGNEQMKIENFEAAVSFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVRDCERAIGIDPYYSKAYGRMGLALSSLNKHTEAVVYYKKALELDPENDTYKSNLKIAEQKMKETPSPTGGTGGFDQLAGLLNNPGFMSMASNLMNNPQVQQLGQQFAQQMQQQNPELIEQLRSQIRSRTPSASNDDQQE",
        "proteome": "UP000007648",
        "gene": "SGTA",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d4ec26cc349f58c2060a8d08a2242eb5b50cbce5",
        "counters": {
            "domain_architectures": 789,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 3,
                "ssf": 1,
                "profile": 2,
                "smart": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 789
        }
    }
}