GET /api/protein/UniProt/A0A7M7PQU3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M7PQU3",
"id": "A0A7M7PQU3_STRPU",
"source_organism": {
"taxId": "7668",
"scientificName": "Strongylocentrotus purpuratus",
"fullName": "Strongylocentrotus purpuratus (Purple sea urchin)"
},
"name": "Uridine diphosphate glucose pyrophosphatase NUDT14",
"description": [
"Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP-mannose"
],
"length": 209,
"sequence": "MADQISDVSVSLCSSSKYVTPFRLNYKQDGVEKTWDYIKGHDSIAILLYNKDRDVFPVVKQFRPAVYAAKIKAFTDGQKVDTDKHKGEEGMTLELCAGLMDKDKDVTEMAQAEVLEETGYKVPLENLKKITSFRNGVGVRGTLQTQFYAEVTDQMKVGSGGGLVDEGEQIEVVELSGRDALKFIMDETITKPVWMMFAFTWFFFMKDKE",
"proteome": "UP000007110",
"gene": null,
"go_terms": [
{
"identifier": "GO:0016818",
"name": "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cdd": 1,
"profile": 1,
"cathgene3d": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1
}
}
}