General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7M7IXJ8",
        "id": "A0A7M7IXJ8_VARDE",
        "source_organism": {
            "taxId": "109461",
            "scientificName": "Varroa destructor",
            "fullName": "Varroa destructor (Honeybee mite)"
        },
        "name": "Large ribosomal subunit protein uL29",
        "description": null,
        "length": 121,
        "sequence": "MLRAAELRGMKKEEFEKTIEELKNEMTTLRVAKMAGAPPSKVSKIGVIRRNLARIYTIMNEMKRENLIKFYRNKKRVPLDLRLKRTRAQRRALTPYEKSRKTRKQHRHECSFPQRKFALKA",
        "proteome": "UP000594260",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0000463",
                "name": "maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0022625",
                "name": "cytosolic large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "711924de1a0dd8285cf1d4531ce96a2804131cc6",
        "counters": {
            "domain_architectures": 30896,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30896
        }
    }
}