GET /api/protein/UniProt/A0A7M7GIF6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M7GIF6",
"id": "A0A7M7GIF6_STRPU",
"source_organism": {
"taxId": "7668",
"scientificName": "Strongylocentrotus purpuratus",
"fullName": "Strongylocentrotus purpuratus (Purple sea urchin)"
},
"name": "Glutamine amidotransferase-like class 1 domain-containing protein 1",
"description": [
"Component of the FERRY complex (Five-subunit Endosomal Rab5 and RNA/ribosome intermediary). The FERRY complex directly interacts with mRNAs and RAB5A, and functions as a RAB5A effector involved in the localization and the distribution of specific mRNAs most likely by mediating their endosomal transport. The complex recruits mRNAs and ribosomes to early endosomes through direct mRNA-interaction"
],
"length": 224,
"sequence": "MAKPQCLLLLSSSSEGGIQAQSFIHAFTLAHSAFNVQLASIEGRLGDFVGHDDNSKRWISDFRSKPYSMPLRLDVVEPSRYAALLIPDCTGALYDLTKDRILCDLIRHFVAEKKLICAIGSGVAALCSTKKTEGKFSKWLFASYCLTAPSVYELVRSSSFASLPIILEDFIKDNAGKYTASEAGAIHVVVDRCLITGQNEASTIMAVQNLILATNSRQGKPVGW",
"proteome": "UP000007110",
"gene": null,
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1
}
}
}