GET /api/protein/UniProt/A0A7M7G6R8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M7G6R8",
"id": "A0A7M7G6R8_NASVI",
"source_organism": {
"taxId": "7425",
"scientificName": "Nasonia vitripennis",
"fullName": "Nasonia vitripennis (Parasitic wasp)"
},
"name": "Transcription initiation factor IIA subunit 2",
"description": [
"TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation"
],
"length": 115,
"sequence": "MSYQLYRNTTLGNTLEETLDDLLAYDQISRGLAVKVLLQFDKAMNQALTTKVKSRLNFKAGNLKTYRFCDNVWTLMLHDVEFRDSQRVDSIHVDKVKIVACEGGKTLDADGSSKR",
"proteome": "UP000002358",
"gene": "100122626",
"go_terms": [
{
"identifier": "GO:0006367",
"name": "transcription initiation at RNA polymerase II promoter",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005672",
"name": "transcription factor TFIIA complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "129e83f6b2f9b7f8f58ced155fef04f6239df37d",
"counters": {
"domain_architectures": 4124,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cdd": 2,
"cathgene3d": 2,
"ssf": 2,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4124
}
}
}