GET /api/protein/UniProt/A0A7M6UCG3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M6UCG3",
"id": "A0A7M6UCG3_APIME",
"source_organism": {
"taxId": "7460",
"scientificName": "Apis mellifera",
"fullName": "Apis mellifera (Honeybee)"
},
"name": "Heat shock factor-binding protein 1",
"description": [
"Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process"
],
"length": 84,
"sequence": "MADIKQDHKGEDTDNYGIGNNAEPKNMQELTEYVQTLLQNMQGKFQTMSDQILGKIDEMGNRIDDLEKNITDLMTQAGVEGGDK",
"proteome": "UP000005203",
"gene": "LOC725609",
"go_terms": [
{
"identifier": "GO:0003714",
"name": "transcription corepressor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f29886ab4101a0363507121d30a1a2175694fa66",
"counters": {
"domain_architectures": 3893,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3893
}
}
}