GET /api/protein/UniProt/A0A7M4G307/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M4G307",
"id": "A0A7M4G307_CROPO",
"source_organism": {
"taxId": "8502",
"scientificName": "Crocodylus porosus",
"fullName": "Crocodylus porosus (Saltwater crocodile)"
},
"name": "Tetraspanin-10",
"description": [
"Part of TspanC8 subgroup, composed of 6 members that interact with the transmembrane metalloprotease ADAM10. This interaction is required for ADAM10 exit from the endoplasmic reticulum and for enzymatic maturation and trafficking to the cell surface as well as substrate specificity. Different TspanC8/ADAM10 complexes have distinct substrates"
],
"length": 364,
"sequence": "PFLFAAIWAESPELRPAAEEPELVQRCWGGGLLWVKPTDSFALSPSHQRPGLGRLFPVSHLRDVLSFSTEDPDADHACLGKWQRLEPPLGTCSSCVRYVAFSWNLLFSILGLLTLAVGVWGLLDKESLLGEHVGLLGTDPMLFLALVGLAVSTLSLAGCAGALYANICLLKFFTGGVLTFVAMELLGGLLLYTLRHRIKDSLRDTMLLAVLRYQDDLDLQFLMDEIQTGLQCCGVESYLDWETNLYFNCSSPGVQACGVPASCCLEPLGNGTIANSQCGFGALGLVASVAAGTISLGGCLPQVTRWLNSHVGVIGSYFACLLAVEVGSLLLATKLLVDVALARAAIQMTRGTSLDPGHTGPMGT",
"proteome": "UP000594220",
"gene": "TSPAN10",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2f035c93bc0f873636b5d7b827745b2654062619",
"counters": {
"domain_architectures": 63859,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 63859
}
}
}