GET /api/protein/UniProt/A0A7M4FUU9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M4FUU9",
"id": "A0A7M4FUU9_CROPO",
"source_organism": {
"taxId": "8502",
"scientificName": "Crocodylus porosus",
"fullName": "Crocodylus porosus (Saltwater crocodile)"
},
"name": "Phosphatidylethanolamine-binding protein 1",
"description": [
"HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor"
],
"length": 187,
"sequence": "MPLELAQWGGPLSLGEVEQQPAQPLRVKYGSVEIDELGKVLTPTQVQSRPTSIEWDGCDPQKLYTLVLTDPDAPSRKDPKFREWHHFLVINMKGNDIKSGQILSDYVGSGPPKGTGLHRYVWLVYEQTQQLSCNEPILSNRCGDHRGKFKVASFRNKYKLGAPVAGTCYQAEWDDYVPKLYEQLSGK",
"proteome": "UP000594220",
"gene": "PEBP1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7ef5b96685b452b08c582f63e3f24b82a48d2ec8",
"counters": {
"domain_architectures": 36417,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36417
}
}
}