GET /api/protein/UniProt/A0A7M3TH53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7M3TH53",
"id": "A0A7M3TH53_9CAUD",
"source_organism": {
"taxId": "2768772",
"scientificName": "Salmonella phage vB_Sen-E22",
"fullName": "Salmonella phage vB_Sen-E22"
},
"name": "Holin",
"description": [
"Accumulates harmlessly in the cytoplasmic membrane until it reaches a critical concentration that triggers the formation of micron-scale pores (holes) causing host cell membrane disruption and endolysin escape into the periplasmic space. Determines the precise timing of host cell lysis. Regulated by specific antiholins that somehow sense superinfections and then delay lysis. Participates with the endolysin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles from the host cell"
],
"length": 218,
"sequence": "MEKFLQLLTVLLQEAKDPASLLKRLLTILVAVIIFLFVSNTSEVMSFLKTFSTSAVLQDVQTQRISNFPNVAREKSMVLFSQTGADAVFVVKYKPDAINDYSNIIAWESNAQLDRADLADKAVNKTSELYRRHLDGFNYASDLSVKVNKYMGLNIPAFKNVTFNYIYTCPYFNLNNIYAGYIGIAWKDNPVDAADSEKFNEYLTKLCSPQQRSLGRSI",
"proteome": "UP000593989",
"gene": "vBSenE22_050",
"go_terms": [
{
"identifier": "GO:0044659",
"name": "viral release from host cell by cytolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "6a739f8d11cf6c5ad592fb3ecde4efb139f3ebaf",
"counters": {
"domain_architectures": 536,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 536
}
}
}