General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7L9MGD6",
        "id": "A0A7L9MGD6_BRUSS",
        "source_organism": {
            "taxId": "1567501",
            "scientificName": "Brucella suis bv. 4",
            "fullName": "Brucella suis bv. 4"
        },
        "name": "Exonuclease domain-containing protein",
        "description": [
            "DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The epsilon subunit contain the editing function and is a proofreading 3'-5' exonuclease"
        ],
        "length": 332,
        "sequence": "MRHQFDLFAPPSEDGEKREEQRPACGKTAKAPAIDEAEMVKRLKESGRYRILQRLDPPPIVPDADRIAFPRLGVVVDTETTGLNPAQEEIIEIGAVAFRYADDGSIGDVCATFGALQQPSKPIPAEITRITGITDEMVKGRTIPRDELDALIAEADIIIAHNAGFDRPFLERLSIAFANKPWACSVKEIDWTARGFEGTKLGYLIGQSGYFHNGHRAEDDCQALLAVLKGKSGKTTPFAELLKASQRARMRIYAENSPFEMKDHLKARGYRWSDGTDGRPKSWWTEVGEDELEAELEYLRTEIYGWRDADPLIQKLTAMDRYKERGPLRAKK",
        "proteome": null,
        "gene": "HUZ30_11040",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5aad122e81bfc5b649ae462596f1030cc5a1692e",
        "counters": {
            "domain_architectures": 85258,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "smart": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 85258
        }
    }
}