GET /api/protein/UniProt/A0A7L9A2R0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7L9A2R0",
"id": "A0A7L9A2R0_9BROM",
"source_organism": {
"taxId": "1195163",
"scientificName": "Anulavirus ALMMV",
"fullName": "Anulavirus ALMMV"
},
"name": "Movement protein",
"description": [
"Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Acts by forming a tubular structure at the host plasmodesmata, enlarging it enough to allow free passage of virion capsids"
],
"length": 298,
"sequence": "MSILTRSFSSRSLTKLDGAVNEYLGSKEFEDDMRQQAGYGRWKGLKVGGGERSFVLVPENSYNKLTGLFRADYDKGLVPSKGYMHLKWVMVFLVSHVPKSSAGSVTLSLKDPGWSLTDPLPDTSFEMALSSLPRVCLLTTDYDLPLSKKPIKLGDRGEMRRMFLLTAKVTGLVGAGDALSLFPIWDCDFRSSCNNYEVVPCTSVPITRCIRSDVLSCVAELSRYVKGTLLSLPRSSVSGARFAAPELINQNESESDSSTAVVPESAGVRSAPPQGLAQSPALFNGVEDMSKEVIPKIP",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0046740",
"name": "transport of virus in host, cell to cell",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "b8ed3171a57edc81e7de70703fc84f4df56e3ccf",
"counters": {
"domain_architectures": 1914,
"entries": 2,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1914
}
}
}